Type: Recombinant protein
Expression system: E. coli
Species: SARS-CoV-2, Pirola variant
Tag: Will be determined during production. If you have a specific tag requirement, please let us know and will try to use your tag of preference. Tag removal service is also available.
Expression Region: 315-535 aa
Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):
TSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK