Skip to Content

Recombinant SARS-CoV-2 Pirola variant Spike glycoprotein (S), partial, E.coli expression - 1 mg

https://www.gen.bg/web/image/product.template/8182/image_1920?unique=325b45d
(0 review)

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days of Stock Products

Type: Recombinant protein

Expression system: E. coli

Species: SARS-CoV-2, Pirola variant

Tag: Will be determined during production. If you have a specific tag requirement, please let us know and will try to use your tag of preference. Tag removal service is also available.

Expression Region: 315-535 aa

Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

TSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK