Price List Default - EUR
  1. All Products
  2. Recombinant Human Uncharacterized protein C1orf54 (C1orf54), E.coli expression - 1 mg

Recombinant Human Uncharacterized protein C1orf54 (C1orf54), E.coli expression - 1 mg

https://www.gentaur.be/web/image/product.template/19478/image_1920?unique=3b59fe7
(0 review)

Uniprot No: Q8WWF1
Expression Region: 17-131aa (Full Length of Mature Protein)
Tag: C-terminal 6xHis-tag

$ 0.00 0.0 USD $ 0.00

1,632.00 €

    This combination does not exist.

    Contact Us For Price                                                 

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days of Stock Products

    Uniprot No: Q8WWF1

    Expression Region: 17-131aa (Full Length of Mature Protein)

    Tag: C-terminal 6xHis-tag

    Protein Sequence: QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM