Skip to Content

Recombinant Macaca mulatta Interleukin-10 (IL10) - 100 ug

https://www.gen.bg/web/image/product.template/8144/image_1920?unique=325b45d
(0 review)

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days of Stock Products

Target Name: IL10

Uniprot No.: P51496

Research Area: Immunology

Alternative Names: IL10; Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF

Species: Macaca mulatta (Rhesus macaque)

Source: Mammalian cell

Expression Region: 19-178aa


Sequence:

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN


Mol. Weight: 46.4 kDa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal hFc-tagged

Form: Liquid or Lyophilized powder


Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.


Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.