Skip to Content

Recombinant Mycobacterium tuberculosis Phosphate-binding protein (pstS1), partial - 20 ug

https://www.gen.bg/web/image/product.template/10751/image_1920?unique=325b45d
(0 review)

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days of Stock Products

Purity: Greater than 90% as determined by SDS-PAGE.


Target Name: pstS1


Uniprot No.: P9WGU0


Alternative Names: pstS1; phoS1; MT0961; Phosphate-binding protein PstS 1; PBP 1; PstS-1; Antigen Ag78; Protein antigen B; PAB


Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)


Source: E.coli


Expression Region: 24-373aa


Target Protein Sequence:

CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS

*Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Mol. Weight: 39.8 kDa


Protein Length: Partial


Tag Info: N-terminal 6xHis-tagged


Form: Liquid or Lyophilized powder

*Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.


Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.

*Note: If you have any special requirement for the glycerol content, please remark when you place the order.

If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.


Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.


Storage Condition: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.


Shelf Life: 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.


Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.



(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.