Skip to Content

Recombinant Pseudomonas aeruginosa Elastase (lasB) - 20 µg

https://www.gentaur.com.pl/web/image/product.template/7256/image_1920?unique=5d92942
(0 review)

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days of Stock Products

Purity: Greater than 90% as determined by SDS-PAGE.


Target Names: lasB


Uniprot No.: P14756


Alternative Names: lasB; PA3724Elastase; EC 3.4.24.26; Neutral metalloproteinase; PAE; Pseudolysin) [Cleaved into: Pro-elastase]


Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)


Source: E.coli


Expression Region: 198-498aa


Target Protein Sequence: AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL

Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Mol. Weight: 49.1kDa


Protein Length: Full Length of Mature Protein


Tag Info: N-terminal 6xHis-SUMO-tagged


Form: Liquid or Lyophilized powder

Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.


Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.

Note: If you have any special requirement for the glycerol content, please remark when you place the order.

If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.