Хypothetical protein WP_003477458 459bp pUC vector - 100ug plasmid + 200ul glycerol

https://www.gen.bg/web/image/product.template/5440/image_1920?unique=8f28d63

423.30 423.3 USD 423.30

415.00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days of Stock Products

    DNA Sequence:

    RC48GOI: atgagtccatattatagatataaaaaagaaaaatttttagaaaagtatcaatcagcaactgataacttagaagatttaaaagtagcaataaaagaatataaagatactaataatagaattataagaagagctatgtttgctttctttcaagatttcactgaatatattattgatatgtgtgaaagttatatattgataaatgatgggaaaataaagagtacaacttctgcaacacagctagttgaacaagcatatgatatgggcttttttgataatgaactaaaaaaatacttagttttatcagtgaaacttagaaatagatatactcatgattattacctaagagaagagagcgaaaaagcaatagaagaattctgttttttaaaactagcaaatctagaaatatttttagaagaaagtaaggataaagttattcttaaatataaaaatttagtttaaMSPYYRYKKE

    Protein sequence:

    KFLEKYQSATDNLEDLKVAIKEYKDTNNRIIRRAMFAFFQDFTEYIIDMC
    ESYILINDGKIKSTTSATQLVEQAYDMGFFDNELKKYLVLSVKLRNRYTHDYYLREESEKAIEEFCFLKLANLEIFLEESKDKVILKYKNLV