Recombinant Human Growth/differentiation factor 9 (GDF9), Expression: E.coli, Tag: N-terminal GST, 20 ug

https://www.gentaur.be/web/image/product.template/5784/image_1920?unique=0fabe26
(0 review)

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days of Stock Products

Purity: Greater than 90% as determined by SDS-PAGE.

Target Names: GDF9

Uniprot No: O60383

Research Area: Cardiovascular

Alternative Names: GDF9Growth/differentiation factor 9; GDF-9

Species: Homo sapiens (Human)

Expression system: E.coli

Expression Region: 320-454aa

Protein Sequence: GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

Mol. Weight: 42.5kDa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal GST-tagged


(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel: