gene-11131.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9555/image_1920?unique=b5bc216

1,982.88 1982.88 USD 1,982.88

1,944.00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days of Stock Products

    Expression System: E. coli

    Expression Region: Expression Region: 28-368aa;Full Length of mature protein (The 1-27aa is the signal peptide, it usually is removed during the protein expression process.)

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    DDNTPVPGDSSQISSWFQNNVKPFQQRKGSLD

    SELVQAEDDVKIIKVNINGGGDFTTITDAIKSIPAG

    NTKRVIVHIGHGVYKEKIKIERTQPFVTLHGNPQ

    SMPTLTYDGTAAKYGTVDSASLIVESDYFVAANL

    IIQNSAPRPHGQSGAQAAALRISGGKAAFFNCKI

    KGYQDTVCDDRGNHFFKDCYIEGTVDFIFGSGT

    SIYLNTQLYVLGQGNEISFITAHARDFTSETTGYSF

    IHCHISGTGHGTYLGRAWRARPRVVFSYTDMSG

    EVNPLGWSDNNHPERDSTVFFAENKCTGPGAD

    PAKRAKFAKQLSDAEAKPFLSLGFIKGSSWLLPPP

    NV