Custom Mouse anti-Human TRDV3 Monoclonal Antibody

https://www.gentaur.be/web/image/product.template/10048/image_1920?unique=5bc538a

Guaranteed Deliverables:

1.      200ug antigen (used as positive control);
2.      25ul pre-immune serum (used as negative control);
3.      100ul mouse ascites fluid;
4.      Monoclonal antibodies purified from 10ml mouse ascites fluid by Protein A/G;

7,909.08 7909.08 USD 7,909.08

7,754.00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days of Stock Products

    * This is a customized production of a unconjugated mouse monoclonal antibody against human T cell receptor delta variable 3 protein (TRDV3), Uniprot ID # A0JD37.


    Antigen: Recombinant human T cell receptor delta variable 3 protein (19-113aa); Expressed in E. coli;

    Tag Info of Antigen: the tag used for protein expression and purification will be determined during the immunogen preparation, depending on the target protein itself (e.g. stability, hydrophobicity, expression system.);

    Antigen Sequences:

    DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF 

    Notes: Customer can provide a specific protein sequence for the antibody production and the price may vary depending on immunogen options. 


    Guaranteed Deliverables:

    1.      200ug * antigen (used as positive control);

    2.      25ul * pre-immune serum (used as negative control);

    3.      100ul mouse ascites fluid;

    4.      Monoclonal antibodies purified from 10ml mouse ascites fluid by Protein A/G;


    Guaranteed Quality:

    1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.

    2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.

    3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).


    Production time: 24-32 weeks


    Gentaur guarantees the custom antibodies could recognize antigen, and promises to offer positive result of western blot analysis with antigen. However, Gentaur does not guarantee that the custom antibodies must recognize endogenous samples.

    The antibody production is risk-free, we will not charge any fees if the antibody production fails or the generated antibody does not meet the quality guarantee.