Recombinant Macaca mulatta Interleukin-10 (IL10) - 100 ug

https://www.gentaur.be/web/image/product.template/8144/image_1920?unique=2a20a7d
(0 review)

0.00 0.0 USD 0.00

1,074.00 €

info@gentaur.com

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days of Stock Products

    Target Name: IL10

    Uniprot No.: P51496

    Research Area: Immunology

    Alternative Names: IL10; Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF

    Species: Macaca mulatta (Rhesus macaque)

    Source: Mammalian cell

    Expression Region: 19-178aa


    Sequence:

    SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN


    Mol. Weight: 46.4 kDa

    Protein Length: Full Length of Mature Protein

    Tag Info: C-terminal hFc-tagged

    Form: Liquid or Lyophilized powder


    Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.


    Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.