PTF16 2ug

https://www.gentaur.be/web/image/product.template/3543/image_1920?unique=b0d3b4e
(0 review)

318.24 318.24 USD 318.24

312.00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days of Stock Products

    pTf16

    PVT0805      2ug
     

     

    pTf16 Information

    Replicon: p15A ori
    Plasmid classification: Escherichia coli vector; chaperone expression plasmid
    Plasmid size: 5KB
    Prokaryotic resistance: chloramphenicol Chl
    Cloned strain: DH5 alpha
    Culture conditions: 37 centigrade, aerobic, LB
    Expression host: Escherichia coli
    Culture conditions: 37 centigrade, aerobic, LB
    Inducement: Arabia sugar
    Remarks: plasmids of chaperone

     

     

    pTf16 Sequence

    LOCUS       Exported                5015 bp ds-DNA     circular SYN 12-SEP-2016
    DEFINITION  synthetic circular DNA
    ACCESSION   .
    VERSION     .
    KEYWORDS    Untitled 15
    SOURCE      synthetic DNA construct
      ORGANISM  synthetic DNA construct
    REFERENCE   1  (bases 1 to 5015)
      AUTHORS   .
      TITLE     Direct Submission
      JOURNAL   Exported Monday, September 12, 2016 from SnapGene Viewer 3.1.4
    FEATURES             Location/Qualifiers
         source          1..5015
                         /organism="synthetic DNA construct"
                         /mol_type="other DNA"
         rep_origin      3624..4168
                         /direction=RIGHT
                         /note="p15A ori"
                         /note="Plasmids containing the medium-copy-number p15A
                         origin of replication can be propagated in E. coli cells
                         that contain a second plasmid with the ColE1 origin."
         promoter        4694..4796
                         /note="cat promoter"
                         /note="promoter of the E. coli cat gene encoding
                         chloramphenicol acetyltransferase"
         CDS             4797..441
                         /codon_start=1
                         /gene="cat"
                         /product="chloramphenicol acetyltransferase"
                         /note="CmR"
                         /note="confers resistance to chloramphenicol"
                         /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                         KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                         LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                         DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
    ORIGIN
            1 cgtatggcaa tgaaagacgg tgagctggtg atatgggata gtgttcaccc ttgttacacc
           61 gttttccatg agcaaactga aacgttttca tcgctctgga gtgaatacca cgacgatttc
          121 cggcagtttc tacacatata ttcgcaagat gtggcgtgtt acggtgaaaa cctggcctat
          181 ttccctaaag ggtttattga gaatatgttt ttcgtctcag ccaatccctg ggtgagtttc
          241 accagttttg atttaaacgt ggccaatatg gacaacttct tcgcccccgt tttcaccatg
          301 ggcaaatatt atacgcaagg cgacaaggtg ctgatgccgc tggcgattca ggttcatcat
          361 gccgtctgtg atggcttcca tgtcggcaga atgcttaatg aattacaaca gtactgcgat
          421 gagtggcagg gcggggcgta atttttttaa ggcagttatt ggtgccctta aacgcctggt
          481 gctacgcctg aataagtgat aataagcgga tgaatggcag aaattcgaag aatagttacg
          541 gcttatgaca tctttgtgga cacatcattc actttttatt cacatccggc cctgaactcg
          601 ctaggacttg ccccggtgca ttttttaaat acccgcgaaa aatagagctg atcgtcaaat
          661 ccaacattgc gcccaacggt cgctatcggc attcgcgtag tgctaagcag aagtttcgcc
          721 tggctgatac gctgatcttc gcgccagctc aatacgctaa tgcctaactg ctggcggaac
          781 agatgtgata accgggaggg cgacaggcag acatgctggg cgacgctggc gatatcaaaa
          841 tggctgtccg ccagatggtc gctgatatac tggcaggcat cgcgcacacg gctatccatc
          901 ggcgggtgca acgactcatt aattaccgcc atacgtctga gcaacaactg ctccagcaga
          961 ttgatcgcca gtagctcaga atagcgacct tccccttgcc cggcgctgat gatctgcccg
         1021 aacagttcgc tgaaatgcgg ctggcgcgcc tcgtccgggc ggaaaaatcc tgtctgggca
         1081 aagattgtcg gccaggtcag ccactcctgc cagtaggcgc gaggccggaa ataaacccac
         1141 tggtgatacc actcgctggc gtccggatgc cgtccatagt gatgaatctc gcccggcgga
         1201 aacaataata tatcgccagg ccgacagaca aactgctcgc cattattatt aatgacgccc
         1261 tctccgcgga tggtcaggtt aagaatatat cccttcatgc ccaacggacg atcgataaaa
         1321 aaatccagat atccattcgc ttcaattggc gtcagcccgg cgaccagatg ggcattaaat
         1381 gaatatcccg gcaatagcgg atcattttgc gtttcagcca tgatttctct accccccgat
         1441 gttcagagaa gaaacaaatt gtccatatcg accaggacga cagagcttcc gtctccgcaa
         1501 gactttgcgc ttgatgaaag cacgtatcaa ccccgcttgt gaaaagcgct ttgtaacaaa
         1561 agcgtacagt tcaggcgata aaattaagta acagaagtgt ctataactat ggctggaatg
         1621 tccacattga atatttgcac agcgtcacac tttgcaaagc attagcattt ttgtccataa
         1681 gattagcgga tcctgcctga cggtttttgc cgcgactctc tataatttct ccatacctgt
         1741 ttttctggat ggagtaagac catggccttt cgggatgatt ctggtaacag ggaatgtgat
         1801 tgattataag aacatcccgg ttccgcgaag ccaacaacct gtgcttgcgg ggtaagagtt
         1861 gaccgagcac tgtgattttt tgaggtaaca agatgcaagt ttcagttgaa accactcaag
         1921 gccttggccg ccgtgtaacg attactatcg ctgctgacag catcgagacc gctgttaaaa
         1981 gcgagctggt caacgttgcg aaaaaagtac gtattgacgg cttccgcaaa ggcaaagtgc
         2041 caatgaatat cgttgctcag cgttatggcg cgtctgtacg ccaggacgtt ctgggtgacc
         2101 tgatgagccg taacttcatt gacgccatca ttaaagaaaa aatcaatccg gctggcgcac
         2161 cgacttatgt tccgggcgaa tacaagctgg gtgaagactt cacttactct gtagagtttg
         2221 aagtttatcc ggaagttgaa ctgcagggtc tggaagcgat cgaagttgaa aaaccgatcg
         2281 ttgaagtgac cgacgctgac gttgacggca tgctggatac tctgcgtaaa cagcaggcga
         2341 cctggaaaga aaaagacggc gctgttgaag cagaagaccg cgtaaccatc gacttcaccg
         2401 gttctgtaga cggcgaagag ttcgaaggcg gtaaagcgtc tgatttcgta ctggcgatgg
         2461 gccagggtcg tatgatcccg ggctttgaag acggtatcaa aggccacaaa gctggcgaag
         2521 agttcaccat cgacgtgacc ttcccggaag aataccacgc agaaaacctg aaaggtaaag
         2581 cagcgaaatt cgctatcaac ctgaagaaag ttgaagagcg tgaactgccg gaactgactg
         2641 cagaattcat caaacgtttc ggcgttgaag atggttccgt agaaggtctg cgcgctgaag
         2701 tgcgtaaaaa catggagcgc gagctgaaga gcgccatccg taaccgcgtt aagtctcagg
         2761 cgatcgaagg tctggtaaaa gctaacgaca tcgacgtacc ggctgcgctg atcgacagcg
         2821 aaatcgacgt tctgcgtcgc caggctgcac agcgtttcgg tggcaacgaa aaacaagctc
         2881 tggaactgcc gcgcgaactg ttcgaagaac aggctaaacg ccgcgtagtt gttggcctgc
         2941 tgctgggcga agttatccgc accaacgagc tgaaagctga cgaagagcgc gtgaaaggcc
         3001 tgatcgaaga gatggcttct gcgtacgaag atccgaaaga agttatcgag ttctacagca
         3061 aaaacaaaga actgatggac aacatgcgca atgttgctct ggaagaacag gctgttgaag
         3121 ctgtactggc gaaagcgaaa gtgactgaaa aagaaaccac tttcaacgag ctgatgaacc
         3181 agcaggcgta atttacgcag cataacgcgc taaattcgca caaaggcccg tcaccgccag
         3241 gtggtgggct tttttttgtc atgaattttg catggaaccg tgcgaaaagc ctctttcggt
         3301 gttagcgtaa caacaaaaga ttgttatgct tgaaatatgg tgatgccgta cccataacac
         3361 agggactagc tgataatccg tccataaggt tacaatcggt acagcaggtt ttttcaattt
         3421 tatccaggag acggaaatgt catacagcgg cgaacgagat aactttgcac cccatagatc
         3481 tggtaccaag cttatcgatg ataagctgtc aaacatgaga attacaactt atatcgtatg
         3541 gggctgactt caggtgctac atttgaagag ataaattgca ctgaaatcta gaaatatttt
         3601 atctgattaa taagatgatc ttcttgagat cgttttggtc tgcgcgtaat ctcttgctct
         3661 gaaaacgaaa aaaccgcctt gcagggcggt ttttcgaagg ttctctgagc taccaactct
         3721 ttgaaccgag gtaactggct tggaggagcg cagtcaccaa aacttgtcct ttcagtttag
         3781 ccttaaccgg cgcatgactt caagactaac tcctctaaat caattaccag tggctgctgc
         3841 cagtggtgct tttgcatgtc tttccgggtt ggactcaaga cgatagttac cggataaggc
         3901 gcagcggtcg gactgaacgg ggggttcgtg catacagtcc agcttggagc gaactgccta
         3961 cccggaactg agtgtcaggc gtggaatgag acaaacgcgg ccataacagc ggaatgacac
         4021 cggtaaaccg aaaggcagga acaggagagc gcacgaggga gccgccaggg gaaacgcctg
         4081 gtatctttat agtcctgtcg ggtttcgcca ccactgattt gagcgtcaga tttcgtgatg
         4141 cttgtcaggg gggcggagcc tatggaaaaa cggctttgcc gcggccctct cacttccctg
         4201 ttaagtatct tcctggcatc ttccaggaaa tctccgcccc gttcgtaagc catttccgct
         4261 cgccgcagtc gaacgaccga gcgtagcgag tcagtgagcg aggaagcgga atatatcctg
         4321 tatcacatat tctgctgacg caccggtgca gccttttttc tcctgccaca tgaagcactt
         4381 cactgacacc ctcatcagtg ccaacatagt aagccagtat acactccgct agcgctgatg
         4441 tccggcggtg cttttgccgt tacgcaccac cccgtcagta gctgaacagg agggacagct
         4501 gatagaaaca gaagccactg gagcacctca aaaacaccat catacactaa atcagtaagt
         4561 tggcagcatc acccgacgca ctttgcgccg aataaatacc tgtgacggaa gatcacttcg
         4621 cagaataaat aaatcctggt gtccctgttg ataccgggaa gccctgggcc aacttttggc
         4681 gaaaatgaga cgttgatcgg cacgtaagag gttccaactt tcaccataat gaaataagat
         4741 cactaccggg cgtatttttt gagttatcga gattttcagg agctaaggaa gctaaaatgg
         4801 agaaaaaaat cactggatat accaccgttg atatatccca atggcatcgt aaagaacatt
         4861 ttgaggcatt tcagtcagtt gctcaatgta cctataacca gaccgttcag ctggatatta
         4921 cggccttttt aaagaccgta aagaaaaata agcacaagtt ttatccggcc tttattcaca
         4981 ttcttgcccg cctgatgaat gctcatccgg aattc
    //

     

    Caution:
    Product is for research use only!

     

    Search name

    pTf16,Plasmid pTf16,pTf16 vector