PCOMB3X TT, 2 ug

https://www.gentaur.be/web/image/product.template/707/image_1920?unique=ed79419
(0 review)

295.80 295.8 USD 295.80

290.00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days of Stock Products

    pComb3X TT

    Catalog No. PVT10571
    Packing 2ug

     

    pComb3X TT Information
    Function E.coli Cloning plasmid
    Resistance Amp
    Strain Stbl3
    Culture temperature 37degrees centigrade
    Replicon pBR322F3
    Copy high
    Promoter Lac/lac

    Promoter: Lac/lac promoter

    Plasmid size: 4766bp

    Prokaryotic resistance: ampicillin Amp

    Cloned strain: Escherichia coli Stbl3

     

    pComb3X TT Description

    pComb3XTT plasmid is a phage display plasmid.

     

    pComb3X TT Sequence

    LOCUS       Exported                4766 bp ds-DNA     circular SYN 08-JAN-2017

    DEFINITION  synthetic circular DNA

    KEYWORDS    pComb3XTT

    SOURCE      synthetic DNA construct

      ORGANISM  synthetic DNA construct

    REFERENCE   1  (bases 1 to 4766)

      AUTHORS   .

      TITLE     Direct Submission

    FEATURES             Location/Qualifiers

         source          1..4766

                         /organism="synthetic DNA construct"

                         /mol_type="other DNA"

         protein_bind    109..130

                         /bound_moiety="E. coli catabolite activator protein"

                         /note="CAP binding site"

                         /note="CAP binding activates transcription in the presence 

                         of cAMP."

         promoter        145..175

                         /note="lac promoter"

                         /note="promoter for the E. coli lac operon"

         protein_bind    183..199

                         /bound_moiety="lac repressor encoded by lacI"

                         /note="lac operator"

                         /note="The lac repressor binds to the lac operator to 

                         inhibit transcription in E. coli. This inhibition can be 

                         relieved by adding lactose or 

                         isopropyl-beta-D-thiogalactopyranoside (IPTG)."

         misc_feature    294..1715

                         /note="TT Fab"

                         /note="human Fab to tetanus toxin"

         misc_feature    294..926

                         /note="Light Chain"

         misc_feature    957..1715

                         /note="Heavy Chain"

         misc_feature    957..1034

                         /note="PelB Leader"

         misc_feature    1041..1715

                         /note="Heavy Chain"

         CDS             1737..1754

                         /codon_start=1

                         /product="6xHis affinity tag"

                         /note="6xHis"

                         /translation="HHHHHH"

         CDS             1761..1787

                         /codon_start=1

                         /product="HA (human influenza hemagglutinin) epitope tag"

                         /note="HA"

                         /translation="YPYDVPDYA"

         CDS             1893..2327

                         /codon_start=1

                         /note="geneIII"

                         /translation="MANANKGAMTENADENVLQSDAKGKLDSVATDYGAAIDGFIGDVS

                         GLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFGAGKPYE

                         FSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES"

         rep_origin      complement(2381..2836)

                         /direction=LEFT

                         /note="f1 ori"

                         /note="f1 bacteriophage origin of replication; arrow 

                         indicates direction of (+) strand synthesis"

         promoter        2863..2967

                         /gene="bla"

                         /note="AmpR promoter"

         CDS             2968..3828

                         /codon_start=1

                         /gene="bla"

                         /product="beta-lactamase"

                         /note="AmpR"

                         /note="confers resistance to ampicillin, carbenicillin, and

                         related antibiotics"

                         /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                         ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                         PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                         EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                         LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                         LIKHW"

         rep_origin      3999..4587

                         /direction=RIGHT

                         /note="ori"

                         /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                         replication"

    ORIGIN

            1 agagcgccca atacgcaaac cgcctctccc cgcgcgttgg ccgattcatt aatgcagctg

           61 gcacgacagg tttcccgact ggaaagcggg cagtgagcgc aacgcaatta atgtgagtta

          121 gctcactcat taggcacccc aggctttaca ctttatgctt ccggctcgta tgttgtgtgg

          181 aattgtgagc ggataacaat tgaattcagg aggaatttaa aatgaaaaag acagctatcg

          241 cgattgcagt ggcactggct ggtttcgcta ccgtggccca ggcggccgag ctcacgcagt

          301 ctccaggcac cctgtctttg tctccagggg aaagagccac cctctcctgc agggccagtc

          361 acagtgttag cagggcctac ttagcctggt accagcagaa acctggccag gctcccaggc

          421 tcctcatcta tggtacatcc agcagggcca ctggcatccc agacaggttc agtggcagtg

          481 ggtctgggac agacttcact ctcaccatca gcagactgga gcctgaagat tttgcagtgt

          541 actactgtca gcagtatggt ggctcaccgt ggttcggcca agggaccaag gtggaactca

          601 aacgaactgt ggctgcacca tctgtcttca tcttcccgcc atctgatgag cagttgaaat

          661 ctggaactgc ctctgttgtg tgcctgctga ataacttcta tcccagagag gccaaagtac

          721 agtggaaggt ggataacgcc ctccaatcgg gtaactccca ggagagtgtc acagagcagg

          781 acagcaagga cagcacctac agcctcagca gcaccctgac gctgagcaaa gcagactacg

          841 agaaacacaa agtctacgcc tgcgaagtca cccatcaggg cctgagcttg cccgtcacaa

          901 agagcttcaa caggggagag tgttagttct agataattaa ttaggaggaa tttaaaatga

          961 aatacctatt gcctacggca gccgctggat tgttattact cgctgcccaa ccagccatgg

         1021 ccgaggtgca gctgctcgag cagtctgggg ctgaggtgaa gaagcctggg tcctcggtga

         1081 aggtctcctg cagggcttct ggaggcacct tcaacaatta tgccatcagc tgggtgcgac

         1141 aggcccctgg acaagggctt gagtggatgg gagggatctt ccctttccgt aatacagcaa

         1201 agtacgcaca acacttccag ggcagagtca ccattaccgc ggacgaatcc acgggcacag

         1261 cctacatgga gctgagcagc ctgagatctg aggacacggc catatattat tgtgcgagag

         1321 gggatacgat ttttggagtg accatgggat actacgctat ggacgtctgg ggccaaggga

         1381 ccacggtcac cgtctccgca gcctccacca agggcccatc ggtcttcccc ctggcaccct

         1441 cctccaagag cacctctggg ggcacagcgg ccctgggctg cctggtcaag gactacttcc

         1501 ccgaaccggt gacggtgtcg tggaactcag gcgccctgac cagcggcgtg cacaccttcc

         1561 cggctgtcct acagtcctca ggactctact ccctcagcag cgtggtgacc gtgccctcca

         1621 gcagcttggg cacccagacc tacatctgca acgtgaatca caagcccagc aacaccaagg

         1681 tggacaagaa agttgagccc aaatcttgtg acaaaactag tggccaggcc ggccagcacc

         1741 atcaccatca ccatggcgca tacccgtacg acgttccgga ctacgcttct taggagggtg

         1801 gtggctctga gggtggcggt tctgagggtg gcggctctga gggaggcggt tccggtggtg

         1861 gctctggttc cggtgatttt gattatgaaa agatggcaaa cgctaataag ggggctatga

         1921 ccgaaaatgc cgatgaaaac gtgctacagt ctgacgctaa aggcaaactt gattctgtcg

         1981 ctactgatta cggtgctgct atcgatggtt tcattggtga cgtttccggc cttgctaatg

         2041 gtaatggtgc tactggtgat tttgctggct ctaattccca aatggctcaa gtcggtgacg

         2101 gtgataattc acctttaatg aataatttcc gtcaatattt accttccctc cctcaatcgg

         2161 ttgaatgtcg cccttttgtc tttggcgctg gtaaaccata tgaattttct attgattgtg

         2221 acaaaataaa cttattccgt ggtgtctttg cgtttctttt atatgttgcc acctttatgt

         2281 atgtattttc tacgtttgct aacatactgc gtaataagga gtcttaagct agctaattaa

         2341 tttaagcggc cgcagatctg ctctctgagg aggatctggg aaattgtaag cgttaatatt

         2401 ttgttaaaat tcgcgttaaa tttttgttaa atcagctcat tttttaacca ataggccgaa

         2461 atcggcaaaa tcccttataa atcaaaagaa tagaccgaga tagggttgag tgttgttcca

         2521 gtttggaaca agagtccact attaaagaac gtggactcca acgtcaaagg gcgaaaaacc

         2581 gtctatcagg gcgatggccc actacgtgaa ccatcaccct aatcaagttt tttggggtcg

         2641 aggtgccgta aagcactaaa tcggaaccct aaagggagcc cccgatttag agcttgacgg

         2701 ggaaagccgg cgaacgtggc gagaaaggaa gggaagaaag cgaaaggagc gggcgctagg

         2761 gcgctggcaa gtgtagcggt cacgctgcgc gtaaccacca cacccgccgc gcttaatgcg

         2821 ccgctacagg gcgcgtcagg tggcactttt cggggaaatg tgcgcggaac ccctatttgt

         2881 ttatttttct aaatacattc aaatatgtat ccgctcatga gacaataacc ctgataaatg

         2941 cttcaataat attgaaaaag gaagagtatg agtattcaac atttccgtgt cgcccttatt

         3001 cccttttttg cggcattttg ccttcctgtt tttgctcacc cagaaacgct ggtgaaagta

         3061 aaagatgctg aagatcagtt gggtgcacga gtgggttaca tcgaactgga tctcaacagc

         3121 ggtaagatcc ttgagagttt tcgccccgaa gaacgttttc caatgatgag cacttttaaa

         3181 gttctgctat gtggcgcggt attatcccgt attgacgccg ggcaagagca actcggtcgc

         3241 cgcatacact attctcagaa tgacttggtt gagtactcac cagtcacaga aaagcatctt

         3301 acggatggca tgacagtaag agaattatgc agtgctgcca taaccatgag tgataacact

         3361 gcggccaact tacttctgac aacgatcgga ggaccgaagg agctaaccgc ttttttgcac

         3421 aacatggggg atcatgtaac tcgccttgat cgttgggaac cggagctgaa tgaagccata

         3481 ccaaacgacg agcgtgacac cacgatgcct gtagcaatgg caacaacgtt gcgcaaacta

         3541 ttaactggcg aactacttac tctagcttcc cggcaacaat taatagactg gatggaggcg

         3601 gataaagttg caggaccact tctgcgctcg gcccttccgg ctggctggtt tattgctgat

         3661 aaatctggag ccggtgagcg tgggtctcgc ggtatcattg cagcactggg gccagatggt

         3721 aagccctccc gtatcgtagt tatctacacg acggggagtc aggcaactat ggatgaacga

         3781 aatagacaga tcgctgagat aggtgcctca ctgattaagc attggtaact gtcagaccaa

         3841 gtttactcat atatacttta gattgattta aaacttcatt tttaatttaa aaggatctag

         3901 gtgaagatcc tttttgataa tctcatgacc aaaatccctt aacgtgagtt ttcgttccac

         3961 tgagcgtcag accccgtaga aaagatcaaa ggatcttctt gagatccttt ttttctgcgc

         4021 gtaatctgct gcttgcaaac aaaaaaacca ccgctaccag cggtggtttg tttgccggat

         4081 caagagctac caactctttt tccgaaggta actggcttca gcagagcgca gataccaaat

         4141 actgtccttc tagtgtagcc gtagttaggc caccacttca agaactctgt agcaccgcct

         4201 acatacctcg ctctgctaat cctgttacca gtggctgctg ccagtggcga taagtcgtgt

         4261 cttaccgggt tggactcaag acgatagtta ccggataagg cgcagcggtc gggctgaacg

         4321 gggggttcgt gcacacagcc cagcttggag cgaacgacct acaccgaact gagataccta

         4381 cagcgtgagc tatgagaaag cgccacgctt cccgaaggga gaaaggcgga caggtatccg

         4441 gtaagcggca gggtcggaac aggagagcgc acgagggagc ttccaggggg aaacgcctgg

         4501 tatctttata gtcctgtcgg gtttcgccac ctctgacttg agcgtcgatt tttgtgatgc

         4561 tcgtcagggg ggcggagcct atggaaaaac gccagcaacg cggccttttt acggttcctg

         4621 gccttttgct ggccttttgc tcacatgttc tttcctgcgt tatcccctga ttctgtggat

         4681 aaccgtatta ccgcctttga gtgagctgat accgctcgcc gcagccgaac gaccgagcgc

         4741 agcgagtcag tgagcgagga agcgga

    //

    Caution:
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.Take 2ul plasmid into 100 μ L corresponding competent cell, centrifugal then full coating on plate.
    3.  Shipping temperature is 2-8℃.